Enfuvirtide Systematic (IUPAC) name YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF Identifiers CAS number 159519-65-0 ATC code J05AX07 PubChem  ? DrugBank BTD00106 Chemical data Formula C202H298N50O64  Mol. weight 4450.8 g/mol Pharmacokinetic data Bioavailability 84.3% (SC) Protein binding 92% Metabolism Hepatic Half life 3.8 hours Excretion unknown Therapeutic considerations Pregnancy cat. B2 (Au), B (U.S.) Legal status S4 (Au), POM (UK), â„ž- ...
Wikipedia - [full article]

From the WEST  scientific·clinical

From the EAST  traditional·alternative





Fuzeon Consumer Information
... Fuzeon is used with other anti-HIV medicines to treat adults and children ages 6 years and older with HIV infection. Fuzeon is not used by itself to treat HIV infection. Fuzeon does not cure HIV-infec...
Source: U.S. Food and Drug Administration

   

Resources