Enfuvirtide Systematic (IUPAC) name YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF Identifiers CAS number 159519-65-0 ATC code J05AX07 PubChem  ? DrugBank BTD00106 Chemical data Formula C202H298N50O64  Mol. weight 4450.8 g/mol Pharmacokinetic data Bioavailability 84.3% (SC) Protein binding 92% Metabolism Hepatic Half life 3.8 hours Excretion unknown Therapeutic considerations Pregnancy cat. B2 (Au), B (U.S.) Legal status S4 (Au), POM (UK), â„ž- ...
Wikipedia - [full article]
